VEGFA (NM_001033756) Human Recombinant Protein

Product Code
TP723472
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human vascular endothelial growth factor A (VEGFA), transcript variant 7.
More Information
SKU TP723472
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol VEGFA
aa sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Tag Untagged
Accession No NM_001033756
Gene id 7422
Gene synonyms MVCD1, VEGF, VPF
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 2 Weeks