VEGF165, Human (Sf9-derived)
Product Code
AMS.91001-1
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | AMS.91001-1 |
|---|---|
| Size | 10 ug |
| Application | Useful for cell culture and for the study of signaling and developmental pathways. Also useful for receptor binding studies, screening inhibitors, and selectivity profiling. |
| Species | Human |
| Expression Host | Insect Cells, Sf9 Cells |
| aa sequence | 207-371: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Accession No | NM_001025368 |
| Gene synonyms | Vascular endothelial growth factor 165, VEGF |
| Storage | At least 6 months at -80C |
| Shipping Temp | Dry Ice |
| Supplier Name | BPS |