VEGF120, murine recombinant
Product Code
4964-1000
$9,015.00
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | 4964-1000 |
|---|---|
| Size | 1 mg |
| Species | Mouse |
| Expression Host | E. coli |
| Gene symbol | VEGFA |
| aa sequence | MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Accession No | Q00731 |
| Gene id | 22339 |
| Gene synonyms | Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609, VPF, glioma derived endothelial cell mitogen. |
| Storage | -20C |
| Shipping Temp | Blue Ice |
| Supplier Name | BioVision |