UPRT (NM_145052) Human Mass Spec Standard

Product Code
PH305030
$2,455.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

UPRT MS Standard C13 and N15-labeled recombinant protein (NP_659489)
More Information
SKU PH305030
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol UPRT
aa sequence MGSSHHHHHHSSGLVPRGSHMATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVL
Tag DDK, Myc
Tag position C-terminal
Accession No NM_145052
Gene id 139596
Gene synonyms FUR1, UPP
Protein Families Druggable Genome
Storage -80
Shipping Temp Dry Ice
Lead Time 3 weeks