UBE2V1 (TMEM189-UBE2V1) (NM_199203) Human Mass Spec Standard
Product Code
PH323133
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
TMEM189 MS Standard C13 and N15-labeled recombinant protein (NP_954673)
| SKU | PH323133 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | TMEM189-UBE2V1 |
| aa sequence | MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_199203 |
| Gene id | 387522 |
| Gene synonyms | CROC-1B, CROC1B, KUA-UEV |
| Protein Families | Transmembrane |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |