TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein
Product Code
TP720902
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human pleckstrin homology-like domain, family A, member 2 (PHLDA2)
| SKU | TP720902 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | PHLDA2 |
| aa sequence | MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTPLEHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_003311 |
| Gene id | 7262 |
| Gene synonyms | BRW1C, BWR1C, HLDA2, IPL, TSSC3 |
| Protein Families | Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |