Trefoil Factor 3 (TFF3) (NM_003226) Human Recombinant Protein
Product Code
TP723436
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human trefoil factor 3 (intestinal) (TFF3).
| SKU | TP723436 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | TFF3 |
| aa sequence | EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Tag | Untagged |
| Accession No | NM_003226 |
| Gene id | 7033 |
| Gene synonyms | ITF, P1B, TFI |
| Protein Families | Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |