TNFRSF1A (NM_001065) Human Recombinant Protein
Product Code
TP723427
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 1A (TNFRSF1A).
| SKU | TP723427 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | TNFRSF1A |
| aa sequence | MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
| Tag | Untagged |
| Accession No | NM_001065 |
| Gene id | 7132 |
| Gene synonyms | CD120a, FPF, MS5, p55, p55-R, p60, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR1-d2, TNFR55 |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein, Transcription Factors |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |