TNF alpha (TNF) (NM_000594) Human Recombinant Protein

Product Code
TP721024
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human tumor necrosis factor (TNF)
More Information
SKU TP721024
Size 50 ug
Species Human
Expression Host E. coli
Gene symbol TNF
aa sequence MVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALLEHHHHHH*
Tag His
Tag position C-terminal
Accession No NM_000594
Gene id 7124
Gene synonyms DIF, TNF-alpha, TNFA, TNFSF2, TNLG1F
Protein Families Transmembrane, Druggable Genome, Secreted Protein, Transcription Factors
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days