TNF alpha (TNF) (NM_000594) Human Recombinant Protein
Product Code
TP721024
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human tumor necrosis factor (TNF)
| SKU | TP721024 |
|---|---|
| Size | 50 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | TNF |
| aa sequence | MVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALLEHHHHHH* |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_000594 |
| Gene id | 7124 |
| Gene synonyms | DIF, TNF-alpha, TNFA, TNFSF2, TNLG1F |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein, Transcription Factors |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |