TGF beta 1 (TGFB1) (NM_000660) Human Recombinant Protein

Product Code
TP723438
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1).
More Information
SKU TP723438
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol TGFB1
aa sequence ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Tag Untagged
Accession No NM_000660
Gene id 7040
Gene synonyms CED, DPD1, LAP, TGFB, TGFbeta
Protein Families Druggable Genome, Secreted Protein, Transcription Factors, ES Cell Differentiation/IPS
Storage -80
Shipping Temp Dry Ice
Lead Time 2 Weeks