Syntaxin 8 (STX8) (NM_004853) Human Recombinant Protein

Product Code
TP720998
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human syntaxin 8 (STX8), transcript variant 1
More Information
SKU TP720998
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol STX8
aa sequence MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
Tag Untagged
Accession No NM_004853
Gene id 9482
Gene synonyms CARB
Protein Families Transmembrane, Druggable Genome
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days