SULT1A2 (NM_177528) Human Mass Spec Standard
Product Code
PH314872
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
SULT1A2 MS Standard C13 and N15-labeled recombinant protein (NP_803564)
| SKU | PH314872 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | SULT1A2 |
| aa sequence | MGSSHHHHHHSSGLVPRGSHMELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKN |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_177528 |
| Gene id | 6799 |
| Gene synonyms | HAST4, P-PST, P-PST 2, ST1A2, STP2, TSPST2 |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |