STAT3 (NM_003150) Human Recombinant Protein
Product Code
TP720889
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 2
| SKU | TP720889 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | STAT3 |
| aa sequence | MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_003150 |
| Gene id | 6774 |
| Gene synonyms | ADMIO, ADMIO1, APRF, HIES |
| Protein Families | Druggable Genome, Transcription Factors |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |