Sonic Hedgehog (SHH) (NM_000193) Human Mass Spec Standard

Product Code
PH322175
$2,455.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

SHH MS Standard C13 and N15-labeled recombinant protein (NP_000184)
More Information
SKU PH322175
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol SHH
aa sequence IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Tag DDK, Myc
Tag position C-terminal
Accession No NM_000193
Gene id 6469
Gene synonyms HHG1, HLP3, HPE3, MCOPCB5, ShhNC, SMMCI, TPT, TPTPS
Protein Families Transmembrane, Druggable Genome, Secreted Protein, ES Cell Differentiation/IPS
Storage -80
Shipping Temp Dry Ice
Lead Time 3 weeks