Slamf6 (NM_030710) Mouse Recombinant Protein
Product Code
TP721125
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Mouse SLAM family member 6 (Slamf6)
| SKU | TP721125 |
|---|---|
| Size | 10 ug |
| Species | Mouse |
| Expression Host | HEK293 |
| Gene symbol | Slamf6 |
| aa sequence | HHHHHHEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN* |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_030710 |
| Gene id | 30925 |
| Gene synonyms | KAL1, KAL1b, Ly108, NTB-A, NTBA, SF2000 |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |