SCF (NM_003994) purified human protein
Product Code
TP720821
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human KIT ligand (KITLG), transcript variant a
| SKU | TP720821 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | SCF |
| aa sequence | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHVDHHHHHH* |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_003994 |
| Gene id | 4254 |
| Gene synonyms | KITLG, FPH2, FPHH, Kitl, KL-1, MGF, SCF, SF, SHEP7 |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |