RSPO1 (NM_001038633) Human Recombinant Protein
Product Code
TP723385
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human R-spondin homolog (Xenopus laevis) (RSPO1).
| SKU | TP723385 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | CHO Cells |
| Gene symbol | RSPO1 |
| aa sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
| Tag | Untagged |
| Accession No | NM_001038633 |
| Gene id | 284654 |
| Gene synonyms | CRISTIN3, RSPO |
| Protein Families | Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 2 Weeks |