RNASE6 (NM_005615) Human Recombinant Protein
Product Code
TP720756
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human ribonuclease, RNase A family, k6 (RNASE6)
| SKU | TP720756 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | RNASE6 |
| aa sequence | WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSILVDHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_005615 |
| Gene id | 6039 |
| Gene synonyms | RAD1, RNasek6, RNS6 |
| Protein Families | Transmembrane, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |