Retn (NM_022984) Mouse Recombinant Protein
Product Code
TP723383
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Mouse resistin (Retn), transcript variant 1.
| SKU | TP723383 |
|---|---|
| Size | 25 ug |
| Species | Mouse |
| Expression Host | E. coli |
| Gene symbol | Retn |
| aa sequence | SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
| Tag | Untagged |
| Accession No | NM_022984 |
| Gene id | 57264 |
| Gene synonyms | ADSF, Fizz3, Rstn, Xcp4 |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |