REG4 (NM_032044) purified human protein
Product Code
TP720798
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human regenerating islet-derived family, member 4 (REG4), transcript variant 2
| SKU | TP720798 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | REG4 |
| aa sequence | DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPVDHHHHHH* |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_032044 |
| Gene id | 83998 |
| Gene synonyms | REG4, GISP, REG-IV, RELP |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |