RANTES (CCL5) (NM_002985) Human Recombinant Protein

Product Code
TP723373
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5).
More Information
SKU TP723373
Size 20 ug
Species Human
Expression Host E. coli
Gene symbol CCL5
aa sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Tag Untagged
Accession No NM_002985
Gene id 6352
Gene synonyms D17S136E, eoCP, RANTES, SCYA5, SIS-delta, SISd, TCP228
Protein Families Transmembrane, Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days