RANTES (CCL5) (NM_002985) Human Recombinant Protein
Product Code
TP723373
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5).
| SKU | TP723373 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | CCL5 |
| aa sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Tag | Untagged |
| Accession No | NM_002985 |
| Gene id | 6352 |
| Gene synonyms | D17S136E, eoCP, RANTES, SCYA5, SIS-delta, SISd, TCP228 |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |