PTPRN (NM_002846) Human Recombinant Protein

Product Code
TP721213
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1
More Information
SKU TP721213
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol PTPRN
aa sequence MGSSHHHHHHSSGLVPRGSHMQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANGGGGSGGGGSGGGGSWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLL
Tag His
Tag position N-terminal
Accession No NM_002846
Gene id 5798
Gene synonyms IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N
Protein Families Transmembrane, Druggable Genome
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days