PLGF (PGF) (NM_002632) Human Recombinant Protein

Product Code
TP723366
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human placental growth factor (PGF), transcript variant 1.
More Information
SKU TP723366
Size 25 ug
Species Human
Expression Host E. coli
Gene symbol PGF
aa sequence LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCCGDAVPRR
Tag Untagged
Accession No NM_002632
Gene id 5228
Gene synonyms D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days