PAK4 (NM_005884) Human Recombinant Protein

Product Code
TP723906
$1,625.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 100µg
More Information
SKU TP723906
Size 100 ug
Species Human
Expression Host E. coli
Gene symbol PAK4
aa sequence GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Tag Untagged
Accession No NM_005884
Gene id 10298
Gene synonyms p21 protein (Cdc42/Rac)-activated kinase 4, p21(CDKN1A)-activated kinase 4, p21-activated kinase 4, protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
Protein Families Druggable Genome, Protein Kinase
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days