PAK4 (NM_005884) Human Mass Spec Standard
Product Code
PH302302
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_005875)
| SKU | PH302302 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | PAK4 |
| aa sequence | GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_005884 |
| Gene id | 10298 |
| Gene synonyms | p21 protein (Cdc42/Rac)-activated kinase 4, p21(CDKN1A)-activated kinase 4, p21-activated kinase 4, protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs |
| Protein Families | Druggable Genome, Protein Kinase |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |