Otoraplin (OTOR) (NM_020157) Human Mass Spec Standard

Product Code
PH310984
$2,455.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

OTOR MS Standard C13 and N15-labeled recombinant protein (NP_064542)
More Information
SKU PH310984
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol OTOR
aa sequence MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Tag DDK, Myc
Tag position C-terminal
Accession No NM_020157
Gene id 56914
Gene synonyms FDP, MIAL1
Protein Families Transmembrane, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 3 weeks