NRG1 (NM_013962) Human Recombinant Protein
Product Code
TP723155
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human neuregulin 1 (NRG1), transcript variant GGF2.
| SKU | TP723155 |
|---|---|
| Size | 50 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | NRG1 |
| aa sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE |
| Tag | Untagged |
| Accession No | NM_013962 |
| Gene id | 3084 |
| Gene synonyms | ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF, NRG1-IT2, SMDF |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein, Transcription Factors |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |