NGF (NM_002506) Human Recombinant Protein
Product Code
TP721236
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF)
| SKU | TP721236 |
|---|---|
| Size | 50 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | NGF |
| aa sequence | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Tag | Untagged |
| Accession No | NM_002506 |
| Gene id | 4803 |
| Gene synonyms | Beta-NGF, HSAN5, NGFB |
| Protein Families | Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | In Stock |