Myelin oligodendrocyte glycoprotein (MOG) (NM_002433) Human Recombinant Protein
Product Code
TP720689
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human myelin oligodendrocyte glycoprotein (MOG), transcript variant beta1
| SKU | TP720689 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | MOG |
| aa sequence | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_002433 |
| Gene id | 4340 |
| Gene synonyms | BTN6, BTNL11, MOGIG2, NRCLP7 |
| Protein Families | Transmembrane |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |