MIG (CXCL9) (NM_002416) Human Recombinant Protein

Product Code
TP723301
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 9 (CXCL9).
More Information
SKU TP723301
Size 20 ug
Species Human
Expression Host E. coli
Gene symbol CXCL9
aa sequence TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Tag Untagged
Accession No NM_002416
Gene id 4283
Gene synonyms CMK, crg-10, Humig, MIG, SCYB9
Protein Families Transmembrane, Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days