Melanoma Inhibitory Activity (MIA) (NM_006533) Human Recombinant Protein
Product Code
TP723296
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human melanoma inhibitory activity (MIA), transcript variant 1.
| SKU | TP723296 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | MIA |
| aa sequence | MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
| Tag | Untagged |
| Accession No | NM_006533 |
| Gene id | 8190 |
| Gene synonyms | CD-RAP |
| Protein Families | Transmembrane, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |