MDC (CCL22) (NM_002990) Human Recombinant Protein

Product Code
TP723291
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22).
More Information
SKU TP723291
Size 20 ug
Species Human
Expression Host E. coli
Gene symbol CCL22
aa sequence YGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Tag Untagged
Accession No NM_002990
Gene id 6367
Gene synonyms A-152E5.1, ABCD-1, DC/B-CK, MDC, SCYA22, STCP-1
Protein Families Transmembrane, Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 2 Weeks