MCP2 (CCL8) (NM_005623) Human Recombinant Protein

Product Code
TP723282
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8).
More Information
SKU TP723282
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol CCL8
aa sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Tag Untagged
Accession No NM_005623
Gene id 6355
Gene synonyms HC14, MCP-2, MCP2, SCYA8, SCYA10
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days