MAP1LC3A (NM_032514) Human Recombinant Protein

Product Code
TP720854
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1
More Information
SKU TP720854
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol MAP1LC3A
aa sequence MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
Tag His
Tag position C-terminal
Accession No NM_032514
Gene id 84557
Gene synonyms ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days