Macrophage inflammatory protein 5 (CCL15) (NM_004167) Human Recombinant Protein
Product Code
TP723318
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1.
| SKU | TP723318 |
|---|---|
| Size | 25 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | CCL15 |
| aa sequence | QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Tag | Untagged |
| Accession No | NM_004167 |
| Gene id | 6359 |
| Gene synonyms | HCC-2, HMRP-2B, Lkn-1, LKN1, MIP-1d, MIP-5, NCC-3, NCC3, SCYA15, SCYL3, SY15 |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |