Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Recombinant Protein

Product Code
TP723317
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18).
More Information
SKU TP723317
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol CCL18
aa sequence AQVGTNKELCCLVYTSWQIPQKFLVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Tag Untagged
Accession No NM_002988
Gene id 6362
Gene synonyms AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days