Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Recombinant Protein

Product Code
TP723315
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-C motif) ligand 19 (CCL19).
More Information
SKU TP723315
Size 20 ug
Species Human
Expression Host E. coli
Gene symbol CCL19
aa sequence GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Tag Untagged
Accession No NM_006274
Gene id 6363
Gene synonyms CKb11, ELC, MIP-3b, MIP3B, SCYA19
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days