LYPLA2 (NM_007260) Human Recombinant Protein
Product Code
TP720900
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human lysophospholipase II (LYPLA2)
| SKU | TP720900 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | LYPLA2 |
| aa sequence | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPVLEHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_007260 |
| Gene id | 11313 |
| Gene synonyms | APT-2, APT2, DJ886K2.4 |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |