ISG15 (NM_005101) Human Recombinant Protein

Name: ISG15 (NM_005101) Human Recombinant Protein
Brand: TP720977
SKU: TP720977
Price: 360 USD
Availability: InStock

Product Code

TP720977

Skip to the end of the images gallery

Skip to the beginning of the images gallery

$360.00

Request Quote for Bulk Pricing

Order Support

Shipping Information

Delivery charges will be calculated during checkout
View Ordering Terms

Product Updates

Keep up to date with product offers, resources and news
Sign up

Overview

Purified recombinant protein of Human ISG15 ubiquitin-like modifier (ISG15)

Product Specifications

More Information
SKU	TP720977
Size	50 ug
Species	Human
Expression Host	E. coli
Gene symbol	ISG15
aa sequence	MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGLEHHHHHH
Tag	His
Tag position	C-terminal
Accession No	NM_005101
Gene id	9636
Gene synonyms	G1P2, hUCRP, IFI15, IMD38, IP17, UCRP
Protein Families	Druggable Genome, Secreted Protein
Storage	-80
Shipping Temp	Dry Ice
Lead Time	5 Days

Datasheet/MSDS

Request Data Sheet

Request MSDS

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

Affordable & consistent controls from 50 tumor cell lines, ideal for IHC, in situ hybridization & NGS applications.

Affordable & consistent controls from 50 tumor cell lines, ideal for IHC, in situ hybridization & NGS applications.

Affordable & consistent controls from 50 tumor cell lines, ideal for IHC, in situ hybridization & NGS applications.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

ISG15 (NM_005101) Human Recombinant Protein

Order Support

Order Support

Order Support

Order Support

Shipping Information

Product Updates

Call us at

Subscribe to our newsletter