ISG15 (NM_005101) Human Mass Spec Standard
Product Code
PH301235
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
ISG15 MS Standard C13 and N15-labeled recombinant protein (NP_005092)
| SKU | PH301235 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | ISG15 |
| aa sequence | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGLEHHHHHH |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_005101 |
| Gene id | 9636 |
| Gene synonyms | G1P2, hUCRP, IFI15, IMD38, IP17, UCRP |
| Protein Families | Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |