INSL3 (NM_005543) Human Mass Spec Standard

Product Code
PH309944
$2,455.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

INSL3 MS Standard C13 and N15-labeled recombinant protein (NP_005534)
More Information
SKU PH309944
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol INSL3
aa sequence LGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPYVDHHHHHH
Tag DDK, Myc
Tag position C-terminal
Accession No NM_005543
Gene id 3640
Gene synonyms ley-I-L, RLF, RLNL
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 3 weeks