IL3 (NM_000588) Human Recombinant Protein

Product Code
TP723223
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human interleukin 3 (colony-stimulating factor, multiple) (IL3).
More Information
SKU TP723223
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol IL3
aa sequence APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Tag Untagged
Accession No NM_000588
Gene id 3562
Gene synonyms IL-3, MCGF, MULTI-CSF
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days