IL24 (NM_006850) Human Recombinant Protein
Product Code
TP723222
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human interleukin 24 (IL24), transcript variant 1.
| SKU | TP723222 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | CHO Cells |
| Gene symbol | IL24 |
| aa sequence | QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKLHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_006850 |
| Gene id | 11009 |
| Gene synonyms | C49A, FISP, IL10B, MDA7, MOB5, ST16 |
| Protein Families | Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |