Il1b (NM_008361) Mouse Recombinant Protein
Product Code
TP723211
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Mouse interleukin 1 beta (Il1b).
| SKU | TP723211 |
|---|---|
| Size | 10 ug |
| Species | Mouse |
| Expression Host | E. coli |
| Gene symbol | Il1b |
| aa sequence | MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
| Tag | Untagged |
| Accession No | NM_008361 |
| Gene id | 16176 |
| Gene synonyms | Il-1b, IL-1beta |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |