Il13 (NM_053828) Rat Recombinant Protein
Product Code
TP723189
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Rat interleukin 13 (Il13).
| SKU | TP723189 |
|---|---|
| Size | 10 ug |
| Species | Rat |
| Expression Host | E. coli |
| Gene symbol | Il13 |
| aa sequence | TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH |
| Tag | Untagged |
| Accession No | NM_053828 |
| Gene id | 116553 |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |