IL1 alpha (IL1A) (NM_000575) Human Recombinant Protein

Product Code
TP723206
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human interleukin 1, alpha (IL1A).
More Information
SKU TP723206
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol IL1A
aa sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Tag Untagged
Accession No NM_000575
Gene id 3552
Gene synonyms IL-1A, IL1, IL1-ALPHA, IL1F1
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days