IL-17A/F, human recombinant
Product Code
4176AF-10
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | 4176AF-10 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | IL17A, IL17F |
| aa sequence | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
| Accession No | IL17A-Q16552, IL17F-Q96PD4 |
| Gene id | IL17A-3605, IL17F-112744 |
| Gene synonyms | IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF |
| Storage | -20C |
| Shipping Temp | Gel Pack |
| Supplier Name | BioVision |