IFNA13 (IFNA1) (NM_024013) Human Mass Spec Standard
Product Code
PH310902
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
IFNA1 MS Standard C13 and N15-labeled recombinant protein (NP_076918)
| SKU | PH310902 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | IFNA1 |
| aa sequence | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEVDHHHHHH |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_024013 |
| Gene id | 3439 |
| Gene synonyms | IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@ |
| Protein Families | Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |