ICAD (DFFA) (NM_004401) Human Recombinant Protein
Product Code
TP720857
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1
| SKU | TP720857 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | DFFA |
| aa sequence | MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDV |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_004401 |
| Gene id | 1676 |
| Gene synonyms | DFF-45, DFF1, ICAD |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |