I 309 (CCL1) (NM_002981) Human Recombinant Protein

Product Code
TP720604
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-C motif) ligand 1 (CCL1)
More Information
SKU TP720604
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol CCL1
aa sequence MKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Tag Untagged
Accession No NM_002981
Gene id 6346
Gene synonyms I-309, P500, SCYA1, SISe, TCA3
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days